Overview

  • Product name

    Anti-KCTD19 antibody
  • Description

    Rabbit polyclonal to KCTD19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human KCTD19 aa 60-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GSTFRHVHYYLYTSKLSFSSCAELNLLYEQA


    Database link: Q17RG1

  • Positive control

    • Rat brain tissue and Mouse testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab215433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling KCTD19 with ab215433 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse testis tissue labeling KCTD19  with ab215433 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Choi E  et al. A novel germ cell-specific protein, SHIP1, forms a complex with chromatin remodeling activity during spermatogenesis. J Biol Chem 283:35283-94 (2008). Read more (PubMed: 18849567) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up