Anti-KCTD6 antibody - C-terminal (ab204317)
Key features and details
- Rabbit polyclonal to KCTD6 - C-terminal
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KCTD6 antibody - C-terminal -
Description
Rabbit polyclonal to KCTD6 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Zebrafish -
Immunogen
Recombinant fragment corresponding to Human KCTD6 aa 168-237 (C terminal).
Sequence:MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERA NENTVEHNWTFCRLARKTDD
Database link: Q8NC69 -
Positive control
- Human duodenum tissue. Human KCTD6 overexpression lysate; A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204317 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 28 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Contains 1 BTB (POZ) domain. - Information by UniProt
-
Database links
- Entrez Gene: 200845 Human
- Entrez Gene: 71393 Mouse
- Entrez Gene: 305792 Rat
- Entrez Gene: 436601 Zebrafish
- SwissProt: Q8NC69 Human
- SwissProt: Q8BNL5 Mouse
- SwissProt: Q6DG99 Zebrafish
- Unigene: 13982 Human
see all -
Alternative names
- BTB/POZ domain-containing protein KCTD6 antibody
- KCASH3 antibody
- kctd6 antibody
see all
Images
-
All lanes : Anti-KCTD6 antibody - C-terminal (ab204317) at 1/100 dilution
Lane 1 : Negative control
Lane 2 : Human KCTD6 overexpression lysate
Developed using the ECL technique.
Predicted band size: 28 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KCTD6 antibody - C-terminal (ab204317)
Immunohistochemical analysis of paraffin-embedded Human duodenum tissue, labeling KCTD6 using ab204317 at a 1/20 dilution.
-
Immunofluorescence analysis of paraformaldehyde-fixed A431 cells labeling KCTD6 using ab204317 at 4 µg/ml.
Protocols
Datasheets and documents
References (0)
ab204317 has not yet been referenced specifically in any publications.