Overview

  • Product name

  • Description

    Rabbit polyclonal to KCTD9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human KCTD9 aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLI


    Database link: Q7L273

  • Positive control

    • A549 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab217282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 43 kDa.

Target

  • Relevance

    KCTD9 contains a potassium channel tetramerisation domain. The N-terminal, cytoplasmic tetramerisation domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. The specific function of KCTD9 is unknown.
  • Cellular localization

    Cytoplasmic and Plasma membrane
  • Database links

  • Alternative names

    • BTB/POZ domain containing protein KCTD9 antibody
    • BTBD27 antibody
    • FLJ20038 antibody
    • KCTD 9 antibody
    • Potassium channel tetramerisation domain containing 9 antibody
    see all

Images

  • Anti-KCTD9 antibody (ab217282) at 1/300 dilution + A549 cell lysate

    Secondary
    Goat anti-rabbit IgG antibody (H+L) HRP conjugated at 1/5000 dilution

    Predicted band size: 43 kDa

References

ab217282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up