Overview

  • Product name

    Anti-KDM4E antibody - N-terminal
  • Description

    Rabbit polyclonal to KDM4E - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human KDM4E aa 60-109 (N terminal). The exact sequence is proprietary. (NP_001155102).
    Sequence:

    YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT


    Database link: B2RXH2

  • Positive control

    • 721_B whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Relevance

    Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • JMJD2E antibody
    • KDM4D-like protein antibody
    • KDM4DL antibody
    • lysine (K)-specific demethylase 4E antibody
    • Lysine specific demethylase 4E antibody
    see all

Images

  • Anti-KDM4E antibody - N-terminal (ab178339) at 1 µg/ml + 721_B whole cell lysate at 10 µg

    Predicted band size: 57 kDa

References

ab178339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up