Overview

  • Product name

    Anti-KDM5A / Jarid1A / RBBP2 antibody
    See all KDM5A / Jarid1A / RBBP2 primary antibodies
  • Description

    Rabbit polyclonal to KDM5A / Jarid1A / RBBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human KDM5A/ Jarid1A/ RBBP2 aa 130-160 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    FEMVTKEKKWSKVGSRLGYLPGKGTGSLLKS


    Database link: P29375

  • Positive control

    • IHC-P - Human laryngeal tissue, Human laryngocarcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12.
  • Sequence similarities

    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.
  • Domain

    The GSGFP motif is required for the interaction with SUZ12.
  • Cellular localization

    Nucleus > nucleolus. Occupies promoters of genes involved in RNA metabolism and mitochondrial function.
  • Information by UniProt
  • Database links

  • Alternative names

    • Histone demethylase JARID1A antibody
    • JARID1A antibody
    • Jumonji/ARID domain containing protein 1A antibody
    • Jumonji/ARID domain-containing protein 1A antibody
    • Kdm5a antibody
    • KDM5A_HUMAN antibody
    • Lysine-specific demethylase 5A antibody
    • RBBP-2 antibody
    • RBBP2 antibody
    • RBP2 antibody
    • Retinoblastoma binding protein 2 antibody
    • Retinoblastoma-binding protein 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human laryngocarcinoma tissue labeling KDM5A / Jarid1A / RBBP2 at 1/200 dilution.

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human laryngeal tissue labeling KDM5A / Jarid1A / RBBP2 at 1/200.

References

ab217292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up