Anti-KDM5B / PLU1 / Jarid1B antibody (ab211366)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to KDM5B / PLU1 / Jarid1B
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-KDM5B / PLU1 / Jarid1B antibody
    See all KDM5B / PLU1 / Jarid1B primary antibodies

  • Description

    Rabbit polyclonal to KDM5B / PLU1 / Jarid1B

  • Host species

    Rabbit

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse

  • Immunogen

    Recombinant fragment corresponding to Human KDM5B/ PLU1/ Jarid1B aa 1401-1481.
    Sequence:

    DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFK LERERSYELVRSAETHSLPSDTSYSEQEDSE


    Database link: Q9UGL1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Human prostate tissue; KDM5B / PLU1 / Jarid1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Target

  • Function

    Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma.

  • Tissue specificity

    Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer (at protein level).

  • Sequence similarities

    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.

  • Domain

    Both the JmjC domain and the JmjN domain are required for enzymatic activity.
    The 2 first PHD-type zinc finger domains are required for transcription repression activity.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    • Alternative names

      • Cancer/testis antigen 31 antibody
      • CT31 antibody
      • Histone demethylase JARID1B antibody
      • JARID1B antibody
      • Jumonji AT rich interactive domain 1B antibody
      • Jumonji/ARID domain-containing protein 1B antibody
      • Kdm5b antibody
      • KDM5B_HUMAN antibody
      • Lysine (K) specific demethylase 5B antibody
      • Lysine demethylase 5B antibody
      • Lysine specific demethylase 5B antibody
      • Lysine-specific demethylase 5B antibody
      • PLU-1 antibody
      • PLU1 antibody
      • PPP1R98 antibody
      • Protein phosphatase 1 regulatory subunit 98 antibody
      • PUT1 antibody
      • putative DNA/chromatin binding motif antibody
      • RBBP2H1A antibody
      • RBP2 like antibody
      • RBP2-H1 antibody
      • Retinoblastoma-binding protein 2 homolog 1 antibody
      • Retinoblastoma-binding protein 2 homolog 1A antibody
      see all

    References (0)

    Publishing research using ab211366? Please let us know so that we can cite the reference in this datasheet.

    ab211366 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab211366.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com