Anti-KDM5B / PLU1 / Jarid1B antibody (ab211366)
Key features and details
- Rabbit polyclonal to KDM5B / PLU1 / Jarid1B
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KDM5B / PLU1 / Jarid1B antibody
See all KDM5B / PLU1 / Jarid1B primary antibodies -
Description
Rabbit polyclonal to KDM5B / PLU1 / Jarid1B -
Host species
Rabbit -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human KDM5B/ PLU1/ Jarid1B aa 1401-1481.
Sequence:DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFK LERERSYELVRSAETHSLPSDTSYSEQEDSE
Database link: Q9UGL1 -
Positive control
- Human prostate tissue; KDM5B / PLU1 / Jarid1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Target
-
Function
Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. -
Tissue specificity
Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer (at protein level). -
Sequence similarities
Belongs to the JARID1 histone demethylase family.
Contains 1 ARID domain.
Contains 1 JmjC domain.
Contains 1 JmjN domain.
Contains 3 PHD-type zinc fingers. -
Domain
Both the JmjC domain and the JmjN domain are required for enzymatic activity.
The 2 first PHD-type zinc finger domains are required for transcription repression activity. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 10765 Human
- Entrez Gene: 75605 Mouse
- Omim: 605393 Human
- SwissProt: Q9UGL1 Human
- SwissProt: Q80Y84 Mouse
- Unigene: 443650 Human
- Unigene: 28995 Mouse
- Unigene: 391994 Mouse
-
Alternative names
- Cancer/testis antigen 31 antibody
- CT31 antibody
- Histone demethylase JARID1B antibody
see all
Protocols
Datasheets and documents
References (0)
ab211366 has not yet been referenced specifically in any publications.