Overview

  • Product name

    Anti-KDM5C / Jarid1C / SMCX antibody - N-terminal
    See all KDM5C / Jarid1C / SMCX primary antibodies
  • Description

    Rabbit polyclonal to KDM5C / Jarid1C / SMCX - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Chicken, Human, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human KDM5C/ Jarid1C/ SMCX aa 1-250. Isoform 4.
    Sequence:

    MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPA IVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMY QSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQ PDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGLMAKDKTLRKKDKEGPEC PPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHS


    Database link: P41229-4

  • Positive control

    • U2OS cell lysate transfected with KDM5C / Jarid1C / SMCX siRNA, U2OS, mouse embryo fibroblasts (MEFs), rat INS1 and chicken DT40 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab190181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
ICC/IF 1/2000.
WB 1/2000. Predicted molecular weight: 175 kDa.

Target

  • Function

    Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements.
  • Tissue specificity

    Expressed in all tissues examined. Highest levels found in brain and skeletal muscle.
  • Involvement in disease

    Defects in KDM5C are the cause of mental retardation syndromic X-linked JARID1C-related (MRXSJ) [MIM:300534]. MRXSJ is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRXSJ patients manifest mental retardation associated with variable features such as slowly progressive spastic paraplegia, seizures, facial dysmorphism.
  • Sequence similarities

    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 2 PHD-type zinc fingers.
  • Domain

    The first PHD-type zinc finger domain recognizes and binds H3-K9Me3.
    Both the JmjC domain and the JmjN domain are required for enzymatic activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DXS1272E antibody
    • Histone demethylase JARID1C antibody
    • JARID1C antibody
    • JmjC domain containing protein SMCX antibody
    • Jumonji AT rich interactive domain 1C antibody
    • Jumonji, AT rich interactive domain 1C (RBP2 like) antibody
    • Jumonji/ARID domain-containing protein 1C antibody
    • KDM5C antibody
    • KDM5C_HUMAN antibody
    • Lysine (K) specific demethylase 5C antibody
    • Lysine-specific demethylase 5C antibody
    • MRX13 antibody
    • MRXJ antibody
    • MRXSCJ antibody
    • MRXSJ antibody
    • Protein SmcX antibody
    • Protein Xe169 antibody
    • rbp2 like protein antibody
    • Selected cDNA on X antibody
    • SMCX antibody
    • Smcx homolog X chromosome antibody
    • SmcX protein antibody
    • Smcy homolog X linked antibody
    • XE169 antibody
    • Xe169 protein antibody
    see all

Images

  • All lanes : Anti-KDM5C / Jarid1C / SMCX antibody - N-terminal (ab190181) at 1/2000 dilution

    Lane 1 : Human U2OS cell lysate
    Lane 2 : Human U2OS cell lysate transfected with KDM5C / Jarid1C / SMCX siRNA
    Lane 3 : Mouse embryo fibroblasts (MEFs) cell lysate
    Lane 4 : Rat INS1 cell lysate
    Lane 5 : Chicken DT40 cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 175 kDa

  • All lanes : Anti-KDM5C / Jarid1C / SMCX antibody - N-terminal (ab190181) at 1/2000 dilution

    Lane 1 : Xenopus laevis crude egg extracts
    Lane 2 : U2OS whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Predicted band size: 175 kDa

  • Western blot analysis using ab190181 of immunoprecipitated U2OS cells extracts:

    Lane 1: Input.

    Lane 2: Immunoprecipitation with control serum.

    Lane 3: Immunoprecipitation with ab190181 (5 µL)

  • Immunofluorescence analysis of U2OS cells labeling KDMC / Jarid1C / SMCX (green) using ab190181 at a 1/2000 dilution. Nuclei were stained with DAPI (blue).

References

This product has been referenced in:

  • McBrayer SK  et al. Autochthonous tumors driven by Rb1 loss have an ongoing requirement for the RBP2 histone demethylase. Proc Natl Acad Sci U S A N/A:N/A (2018). IHC ; Mouse . Read more (PubMed: 29610306) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up