Overview

  • Product name

  • Description

    Rabbit polyclonal to Keap1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Keap1 aa 32-133.
    Sequence:

    MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTL QVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPK VM


    Database link: Q14145

  • Positive control

    • IHC-P: Human cerebral cortex tissue. ICC/IF: U-251 MG cell line. WB: Keap1 over-expression lysate (co-expressed with a C terminal myc-DDK tag ~3.1 kDa in HEK293T)

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab218815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Retains NFE2L2/NRF2 in the cytosol. Functions as substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1. Targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. May also retain BPTF in the cytosol. Targets PGAM5 for ubiquitination and degradation by the proteasome.
  • Tissue specificity

    Broadly expressed, with highest levels in skeletal muscle.
  • Sequence similarities

    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Domain

    The Kelch repeats mediate interaction with NF2L2/NRF2, BPTF and PGAM5.
  • Post-translational
    modifications

    Ubiquitinated and subject to proteasomal degradation.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between cytoplasm and nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytosolic inhibitor of Nrf2 antibody
    • INrf 2 antibody
    • INrf2 antibody
    • Keap 1 antibody
    • KEAP1 antibody
    • KEAP1_HUMAN antibody
    • Kelch like ECH associated protein 1 antibody
    • Kelch like family member 19 antibody
    • Kelch like protein 19 antibody
    • Kelch-like ECH-associated protein 1 antibody
    • Kelch-like protein 19 antibody
    • KIAA0132 antibody
    • KLHL 19 antibody
    • KLHL19 antibody
    • MGC10630 antibody
    • MGC1114 antibody
    • MGC20887 antibody
    • MGC4407 antibody
    • MGC9454 antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence analysis of U-251 MG cells labeling Keap1 with ab218815 at 4 µg/mL (green).

References

ab218815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up