Anti-Keratin 12/K12 antibody (ab169328)
Key features and details
- Mouse polyclonal to Keratin 12/K12
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Keratin 12/K12 antibody
See all Keratin 12/K12 primary antibodies -
Description
Mouse polyclonal to Keratin 12/K12 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Dog -
Immunogen
Full length protein corresponding to Human Keratin 12/K12 aa 1-494. (AAI56642.1)
Sequence:MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFG ASCGGGFSAASMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMG FGGSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEAN TELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASIGNAQL LLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLDELTLTRTDLE MQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND MRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRR AFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQ VRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTD SKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM
Database link: Q99456 -
Positive control
- Keratin 12/K12-transfected 293T cell lysate.
-
General notes
Previously labelled as Keratin 12.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab169328 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. |
Target
-
Function
May play a unique role in maintaining the normal corneal epithelial function. Together with KRT3, essential for the maintenance of corneal epithelium integrity. -
Tissue specificity
Cornea specific. -
Involvement in disease
Defects in KRT12 are a cause of Meesmann corneal dystrophy (MECD) [MIM:122100]; also abbreviated MCD and known as juvenile epithelial corneal dystrophy of Meesmann. MECD is an autosomal dominant disease that causes fragility of the anterior corneal epithelium. Patients are usually asymptomatic until adulthood when rupture of the corneal microcysts may cause erosions, producing clinical symptoms such as photophobia, contact lens intolerance and intermittent diminution of visual acuity. Rarely, subepithelial scarring causes irregular corneal astigmatism and permanent visual impairment. Histological examination shows a disorganized and thickened epithelium with widespread cytoplasmic vacuolation and numerous small, round, debris-laden intraepithelial cysts. -
Sequence similarities
Belongs to the intermediate filament family. - Information by UniProt
-
Database links
- Entrez Gene: 3859 Human
- Omim: 601687 Human
- SwissProt: Q99456 Human
- Unigene: 66739 Human
-
Alternative names
- CK-12 antibody
- Cytokeratin-12 antibody
- K12 antibody
see all
Images
-
All lanes : Anti-Keratin 12/K12 antibody (ab169328) at 1 µg/ml
Lane 1 : Keratin 12/K12-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Developed using the ECL technique.
Predicted band size: 55 kDa
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab169328 has been referenced in 1 publication.
- Sun N et al. Expression and influence of BMP-4 in human dental pulp cells cultured in vitro. Exp Ther Med 16:5112-5116 (2018). PubMed: 30542466