Overview

  • Product name

    Anti-Keratin 12/K12 antibody
    See all Keratin 12/K12 primary antibodies
  • Description

    Rabbit polyclonal to Keratin 12/K12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Keratin 12/K12 aa 438-469.
    Sequence:

    QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK


    Database link: Q99456

  • Positive control

    • IHC-P: Human eye tissue.
  • General notes

    Previously labelled as Keratin 12. 

Properties

Applications

Our Abpromise guarantee covers the use of ab220948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a unique role in maintaining the normal corneal epithelial function. Together with KRT3, essential for the maintenance of corneal epithelium integrity.
  • Tissue specificity

    Cornea specific.
  • Involvement in disease

    Defects in KRT12 are a cause of Meesmann corneal dystrophy (MECD) [MIM:122100]; also abbreviated MCD and known as juvenile epithelial corneal dystrophy of Meesmann. MECD is an autosomal dominant disease that causes fragility of the anterior corneal epithelium. Patients are usually asymptomatic until adulthood when rupture of the corneal microcysts may cause erosions, producing clinical symptoms such as photophobia, contact lens intolerance and intermittent diminution of visual acuity. Rarely, subepithelial scarring causes irregular corneal astigmatism and permanent visual impairment. Histological examination shows a disorganized and thickened epithelium with widespread cytoplasmic vacuolation and numerous small, round, debris-laden intraepithelial cysts.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK-12 antibody
    • Cytokeratin-12 antibody
    • K12 antibody
    • K1C12_HUMAN antibody
    • Keratin 12 antibody
    • Keratin antibody
    • Keratin, type I cytoskeletal 12 antibody
    • Keratin-12 antibody
    • KRT12 antibody
    • type I cytoskeletal 12 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human eye tissue labeling Keratin 12/K12 with ab220948 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human lymph node tissue labeling Keratin 12/K12 with ab220948 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human liver tissue labeling Keratin 12/K12 with ab220948 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling Keratin 12/K12 with ab220948 at 1/200 dilution. 

References

ab220948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up