Anti-Keratinocyte differentiation associated protein antibody (ab204583)

Overview

  • Product name

    Anti-Keratinocyte differentiation associated protein antibody
  • Description

    Rabbit polyclonal to Keratinocyte differentiation associated protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Keratinocyte differentiation associated protein aa 24-81.
    Sequence:

    TLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESI KRKLPFLN


    Database link: P60985

  • Positive control

    • Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May act as a soluble regulator of keratinocyte differentiation. May play an important role in embryonic skin morphogenesis.
  • Tissue specificity

    Highly expressed in skin and detected at lower levels in thymus. In skin, found exclusively in lamellar granules of granular keratinocytes and in the intracellular space of the stratum corneum. Also highly expressed in oral mucosa, tongue, esophagus, and stomach, and at much lower levels in bladder and uterus. Not detected in gastrointestinal mucosa.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • KDAP antibody
    • Keratinocyte differentiation-associated protein antibody
    • Krtdap antibody
    • KTDAP_HUMAN antibody

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human skin tissue sections labeling Keratinocyte differentiation associated protein with ab204583 at a 1/1000 dilution.

References

ab204583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up