Overview

  • Product name

    Anti-Keratocan/KTN antibody
    See all Keratocan/KTN primary antibodies
  • Description

    Rabbit polyclonal to Keratocan/KTN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse Keratocan/KTN aa 196-245 (C terminal). The exact sequence is proprietary.
    Sequence:

    MQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRL


    Database link: NP_032464

  • Positive control

    • Mouse small intestine lysate
  • General notes

    Protein previously labeled as Keratocan.

Properties

Applications

Our Abpromise guarantee covers the use of ab128304 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix.
  • Tissue specificity

    Cornea. Increased expression in the stroma of keratoconus corneas. Also detected in trachea, and in low levels, in intestine, skeletal muscle, ovary, lung and putamen.
  • Involvement in disease

    Defects in KERA are the cause of the autosomal recessive cornea plana 2 (CNA2) [MIM:217300]. In CNA2, the forward convex curvature is flattened, leading to a decrease in refraction, reduced visual activity, extreme hyperopia (usually plus 10 d or more), hazy corneal limbus, opacities in the corneal parenchyma, and marked arcus senilis (often detected at an early age). CNA2 is a rare disorder with a worldwide distribution, but a high prevalence in the Finnish population.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 10 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    Binds keratan sulfate chains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • CNA2 antibody
    • KERA antibody
    • KERA_HUMAN antibody
    • Keratan sulfate proteoglycan keratocan antibody
    • Keratocan antibody
    • KTN antibody
    • SLRR2B antibody
    see all

Images

  • Anti-Keratocan/KTN antibody (ab128304) at 1 µg/ml + Mouse small intestine lysate at 10 µg

    Predicted band size: 40 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Türker E  et al. Vascular Endothelial Growth Factor (VEGF) Induced Downstream Responses to Transient Receptor Potential Vanilloid 1 (TRPV1) and 3-Iodothyronamine (3-T1AM) in Human Corneal Keratocytes. Front Endocrinol (Lausanne) 9:670 (2018). Read more (PubMed: 30524369) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab128304.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up