Overview

  • Product name

    Anti-Keratocan/KTN antibody
    See all Keratocan/KTN primary antibodies
  • Description

    Rabbit polyclonal to Keratocan/KTN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Keratocan/KTN aa 21-352. Full length mature chain without signal peptide.
    Sequence:

    RSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIP SRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQL KKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTL LDLQNNKLVDNAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFL DNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLS HNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGP HLRYLRLDGNEIKPPIPMALMTCFRLLQAVII


    Database link: O60938

  • Positive control

    • IHC-P: Human colon cancer tissue.
  • General notes

    Protein previously labeled as Keratocan.

Properties

Applications

Our Abpromise guarantee covers the use of ab230175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix.
  • Tissue specificity

    Cornea. Increased expression in the stroma of keratoconus corneas. Also detected in trachea, and in low levels, in intestine, skeletal muscle, ovary, lung and putamen.
  • Involvement in disease

    Defects in KERA are the cause of the autosomal recessive cornea plana 2 (CNA2) [MIM:217300]. In CNA2, the forward convex curvature is flattened, leading to a decrease in refraction, reduced visual activity, extreme hyperopia (usually plus 10 d or more), hazy corneal limbus, opacities in the corneal parenchyma, and marked arcus senilis (often detected at an early age). CNA2 is a rare disorder with a worldwide distribution, but a high prevalence in the Finnish population.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 10 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    Binds keratan sulfate chains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • CNA2 antibody
    • KERA antibody
    • KERA_HUMAN antibody
    • Keratan sulfate proteoglycan keratocan antibody
    • Keratocan antibody
    • KTN antibody
    • SLRR2B antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for Keratocan/KTN with ab230175 at 1/100 dilution in immunohistochemical analysis.

References

ab230175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up