Overview

  • Product name

    Anti-KHDC1 antibody [OTI2G6]
  • Description

    Mouse monoclonal [OTI2G6] to KHDC1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human KHDC1 aa 1-164.
    Sequence:

    MDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGDTYLRCIEVH SHTLIQLESWFTATGQTRVTVVGPHRARQWLLHMFCCVGSQDSYHHARGL EMLERVRSQPLTNDDLVTSISVPPYTGDLSLAPRISGTVCLSVPQPSPYQ VIGCSGFHLSSLYP


    Database link: Q4VXA5-2

  • Positive control

    • WB: pCMV6-ENTRY KHDC1 transfected HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI2G6
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200. Predicted molecular weight: 18.3 kDa.

Target

  • Sequence similarities

    Belongs to the KHDC1 family.
    Contains 1 KH domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA257K9.4 antibody
    • C6orf148 antibody
    • KH homology domain containing 1 antibody
    • KH homology domain containing 1B antibody
    • KH homology domain containing protein 1B antibody
    • KH homology domain-containing protein 1 antibody
    • KHDC1 antibody
    • KHDC1_HUMAN antibody
    • MGC10818 antibody
    • NDG1 antibody
    • oocyte specific Khdc1 antibody
    • peptidase M20 domain containing 2 antibody
    see all

Images

  • All lanes : Anti-KHDC1 antibody [OTI2G6] (ab236394) at 1/200 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY KHDC1 transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 18.3 kDa

References

ab236394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up