Overview

  • Product name

    Anti-KIAA0494 antibody
  • Description

    Rabbit polyclonal to KIAA0494
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIAA0494 aa 1-483.
    Sequence:

    MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSDSESSSEEEEE FGVVGNRSRFAKGDYLRCCKICYPLCGFVILAACVVACVGLVWMQVALKE DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV WINITEMNKQISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGN TLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPGSNQIIPSPSA TSELDNKTHSENLKQDILYLHNSLEEVNSALVGYQRQNDLKLEGMNETVS NLTQRVNLIESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTD TVKIQSIKKEDSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVES FTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQDLFRKTGQDV DGKLTYQEIWTSLGSAMPEPESLRAFDSDGDGR


    Database link: O75071

  • Positive control

    • WB: HeLa and Colo320 whole cell lysate. IHC-P: Human thyroid tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.

Target

Images

  • All lanes : Anti-KIAA0494 antibody (ab236107) at 1/500 dilution

    Lane 1 : Colo320 whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human thyroid tissue stained for KIAA0494 using ab236107 at 1/100 dilution in immunohistochemical analysis.

References

ab236107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up