Overview

  • Product name

    Anti-KIAA1107/APache antibody
  • Description

    Rabbit polyclonal to KIAA1107/APache
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIAA1107/APache aa 501-597.
    Sequence:

    AKLDHNTTTEKQAPKRKMVKQVHTALPKVNAKIVAMPKNLNQSKKGETLN NKDSKQKMPPGQVISKTQPSSQRPLKHETSTVQKSMFHDVRDNNNKD

  • Positive control

    • Human Rectum tissue.
  • General notes

     This product was previously labelled as KIAA1107

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent staining of Human cell line U-251MG shows positivity in centrosome. Recommended concentration of ab121799 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • KIAA1107/APache, at 1/150 dilution, staining KIAA1107/APache in paraffin-embedded Human rectum tissue, by Immunohistochemistry.

References

ab121799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Tissue lysate - whole (brain)
Gel Running Conditions
Reduced Denaturing (gel 10%)
Loading amount
35 µg
Specification
brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Abcam user community

Verified customer

Submitted Dec 05 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up