Overview

  • Product name

  • Description

    Rabbit polyclonal to KIAA1429
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human KIAA1429 aa 1049-1146.
    Sequence:

    LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEV LSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVALNTRKL


    Database link: Q69YN4

  • Positive control

    • IHC-P: Human testis, endometrium, skin and rectum tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab246982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS cells stained for KIAA1429 (green) using ab246982 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human rectum tissue stained for KIAA1429 using ab246982 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skin tissue stained for KIAA1429 using ab246982 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human endometrium tissue stained for KIAA1429 using ab246982 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for KIAA1429 using ab246982 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for KIAA1429 using ab246982 at 1/20 dilution in immunohistochemical analysis. Weak positivity, as expected.

References

ab246982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up