Overview

  • Product name

  • Description

    Rabbit polyclonal to KIAA1467
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIAA1467 aa 401-622.
    Sequence:

    LITTRQSLVLLRGQNLTPYWALRLQGLRSQPTPGYFTDDQTLDFLLQIQD GVGMKKMMVVDGDSGSIVWSYRAPCHMKETPATSAVTSDQKSVFLFWAEG LSAASPNSDIILGTEPPSLHHLYLLHPAFPSILLDLANTTGTVTASEVGI NDLWKDAFYVTRTTGPSSEGHPAALVVSKLSLRWALMEGQMAQLQESTPK IGRGELRRFLSRIKFVEAPYEI


    Database link: A2RU67

  • Positive control

    • WB: Human placenta lysate. IHC-P: Human pancreatic tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 67 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    Belongs to the ITFG3 family.
  • Cellular localization

    Membrane; Single pass membrane protein
  • Database links

  • Alternative names

    • Uncharacterized protein KIAA1467 antibody

Images

  • Anti-KIAA1467 antibody (ab236775) at 1/1000 dilution + Human placenta lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 67 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for KIAA1467 (green) using ab236775 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human pancreatic tissue stained for KIAA1467 using ab236775 at 1/100 dilution in immunohistochemical analysis.

References

ab236775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up