Overview

  • Product name

    Anti-KIAA1576 antibody
  • Description

    Rabbit polyclonal to KIAA1576
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human KIAA1576 aa 1-419.
    Sequence:

    MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQEMRAVVLAGF GGLNKLRLFRKAMPEPQDGELKIRVKACGLNFIDLMVRQGNIDNPPKTPL VPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIP DDMSFSEAAAFPMNFVTAYVMLFEVANLREGMSVLVHSAGGGVGQAVAQL CSTVPNVTVFGTASTFKHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIV LDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQVEK VNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKIKPV VDSLWALEEVKEAMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGE EEEDHEGDSENKERMPFIQ


    Database link: Q9HCJ6

  • Positive control

    • WB: U-87 MG whole cell lysate. IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 46 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human colon cancer tissue stained for KIAA1576 using ab235311 at 1/100 dilution in immunohistochemical analysis.

  • Anti-KIAA1576 antibody (ab235311) at 1/500 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 46 kDa

References

ab235311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up