Overview

  • Product name

  • Description

    Rabbit polyclonal to KIF15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    A synthetic peptide corresponding to a region within internal sequence amino acids 1080 - 1129 (

    KKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQLE

    ) of Human KIF15 (NP_064627)

  • Positive control

    • COLO205 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 160 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    KIF15 belongs to the kinesin-like protein family and contains 1 kinesin-motor domain. KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.
  • Cellular localization

    Cytoplasmic, Cytoskeleton, Microtubule Note: Detected during the interphase in the cytoplasm as finely punctuate pattern and irregularly shaped dots. Detected during mitosis on the mitotic spindle. Colocalizes with TPX2 in mitosis. Localizes at the central spindle at anaphase.
  • Database links

  • Alternative names

    • FLJ25667 antibody
    • Kinesin like protein 7 antibody
    • KLP2 antibody
    • HKLP2 antibody
    • Kinesin family member 15 antibody
    • Kinesin like protein 2 antibody
    • Kinesin like protein KIF15 antibody
    • KNSL7 antibody
    • Linesin like 7 antibody
    • NY BR 62 antibody
    • NYBR62 antibody
    • Serologically defined breast cancer antigen NY BR 62 antibody
    • Serologically defined breast cancer antigen NYBR62 antibody
    see all

Images

  • Anti-KIF15 antibody (ab90735) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 160 kDa



    Gel concentration: 6-18%

References

ab90735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Q&A

Answer

Thanks for your reply.

I received a reply from my lab colleagues who informed that the intense band at 65-70kD is either a degradation product of the full-length intact protein, or a non-specific band altogether. We are not absolutely sure exactly what this band is. Only work with positive controls would be able to determine if this was a degradation product of KIF15.

I hope this information was helpful. Please do not hesitate to contact us back for further assistance.

Read More

Answer

Thank you for your reply.

Although we don’t normally offer discount codes for two different untested species / applications, I am happy to make an exception in this occasion as the antibody shares high homology with the mouse protein.

DISCOUNT CODE: XXXXXXX

Expiration date: 11-Sep-12

I am very pleased to hear you would like to accept our offer and test ab90735 in mouse species with IF. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: https://www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: https://www.abcam.com/collaborationdiscount.

Read More

Answer

Thank you for contacting us.

Because we carry over 80,000 products, it isn't feasible for us to keep small sample sizes of our products, and therefore I am not able to offer a test sample of ab90735.

Unfortunately ab90735 has not been tested either with Mouse, nor IF. It doesn’t mean it won’t work in this species / application, but we don’t have data to support it.

However, due to sequence homology, the antibody is very likely to cross react with Mouse. If you are interested in participating in our antibodies evaluation system (Abreview), and test ab90735 with WB and / or human species with ICC/IF (only one untested species/application at a time) I will be happy to offer a discount code for a future purchase if you submit the results (in a form of an Abreview) to our website.

Therefore, I can offer a discount off a future purchase if you buy the antibody and test it in a new species or with a new application and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab90735. I will then send a discount code. This code must be issued before purchasing the antibody so please wait for my reply before ordering.

2. Purchase the antibody either by phone, fax, or online (www.abcam.com).

3. Test it in the new species / application.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!).

To find out more about our Abreview system, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: http://ops.adminsite.com/admin/crm2/www.abcam.com/collaborationdiscount.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up