Overview

  • Product name

  • Description

    Rabbit polyclonal to KIF22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human KIF22 aa 566-648.
    Sequence:

    LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKA QLIVGWRELHGPFSQVEDLERVEGITGKQMESF


    Database link: Q14807

  • Positive control

    • ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Kinesin family that is involved in spindle formation and the movements of chromosomes during mitosis and meiosis. Binds to microtubules and to DNA.
  • Sequence similarities

    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
  • Post-translational
    modifications

    Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • A 328A3.2 antibody
    • KID antibody
    • KIF 22 antibody
    • kif22 antibody
    • KIF22_HUMAN antibody
    • Kinesin family member 22 antibody
    • Kinesin like 4 antibody
    • Kinesin like DNA binding protein antibody
    • Kinesin like DNA binding protein pseudogene antibody
    • Kinesin like protein 4 antibody
    • Kinesin like protein KIF22 antibody
    • Kinesin-like DNA-binding protein antibody
    • Kinesin-like protein 4 antibody
    • Kinesin-like protein KIF22 antibody
    • KNSL 4 antibody
    • KNSL4 antibody
    • OBP 1 antibody
    • OBP 2 antibody
    • OBP antibody
    • OBP1 antibody
    • OBP2 antibody
    • Origin of plasmid DNA replication binding protein antibody
    • OriP binding protein antibody
    • OTTHUMP00000123406 antibody
    • SEMDJL2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for KIF22 (green) using ab222187 at 4 µg/ml in ICC/IF.

References

ab222187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up