Overview

  • Product name

  • Description

    Rabbit polyclonal to KIF2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIF2B aa 544-673.
    Sequence:

    NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQK EIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLS ILEQKIDALTEIQKKLKLLLADLHVKSKVE


    Database link: Q8N4N8

  • Positive control

    • IHC-P: Human skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    KIF2B belongs to the kinesin-like protein family. It is a plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. It also has microtubule depolymerization activity.
  • Cellular localization

    Cytoplasm; cytoskeleton; centrosome. Cytoplasm; cytoskeleton; spindle. Kinetochore. Note: Association with kinetochore is transient.
  • Database links

  • Alternative names

    • FLJ53902 antibody
    • KIF 2B antibody
    • Kinesin family member 2B antibody
    • Kinesin like protein KIF2B antibody
    • Kinesin protein antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for KIF2B using ab234781 at 1/100 dilution in immunohistochemical analysis.

References

ab234781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up