Overview

  • Product name

    Anti-KIF2B antibody - C-terminal
    See all KIF2B primary antibodies
  • Description

    Rabbit polyclonal to KIF2B - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human KIF2B aa 544-673 (C terminal).
    Sequence:

    NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQK EIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLS ILEQKIDALTEIQKKLKLLLADLHVKSKVE


    Database link: Q8N4N8

  • Positive control

    • 293T cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab194789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 76 kDa.

Target

  • Relevance

    KIF2B belongs to the kinesin-like protein family. It is a plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. It also has microtubule depolymerization activity.
  • Cellular localization

    Cytoplasm; cytoskeleton; centrosome. Cytoplasm; cytoskeleton; spindle. Kinetochore. Note: Association with kinetochore is transient.
  • Database links

  • Alternative names

    • FLJ53902 antibody
    • KIF 2B antibody
    • Kinesin family member 2B antibody
    • Kinesin like protein KIF2B antibody
    • Kinesin protein antibody
    see all

Images

  • Anti-KIF2B antibody - C-terminal (ab194789) at 1/500 dilution + 293T cell extract

    Predicted band size: 76 kDa

References

ab194789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up