Overview

  • Product name

    Anti-KIF3C antibody
  • Description

    Rabbit polyclonal to KIF3C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human KIF3C aa 158-267.
    Sequence:

    SKEPGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGST HMNEVSSRSHAIFIITVECSERGSDGQDHIRVGKLNLVDLAGSERQNKAG PNTAGGAATP


    Database link: O14782

  • Positive control

    • WB: Hela and K562 whole cell lysate. IHC-P: Human glioma tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/500.
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000. Predicted molecular weight: 89 kDa.

Target

Images

  • All lanes : Anti-KIF3C antibody (ab236748) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/500 dilution

    Predicted band size: 89 kDa

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells labeling KIF3C (green) using ab236748 at 1/200 dilution in ICC/IFF, follwed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody. Counterstained with DAPI (blue).

  • Paraffin-embedded human glioma tissue stained for KIF3C using ab236748 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up