Anti-KIF4A/KIF4 antibody (ab122227)
Key features and details
- Rabbit polyclonal to KIF4A/KIF4
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KIF4A/KIF4 antibody
See all KIF4A/KIF4 primary antibodies -
Description
Rabbit polyclonal to KIF4A/KIF4 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human KIF4A/KIF4 aa 994-1075.
Sequence:LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIED LKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL
Database link: O95239 -
Positive control
- WB: RT-4 and U-251 MG cell lysates IHC-P: Human bone marrow tissue ICC/IF: Human cell line U-2 OS
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122227 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Motor protein that translocates PRC1 to the plus ends of interdigitating spindle microtubules during the metaphase to anaphase transition, an essential step for the formation of an organized central spindle midzone and midbody and for successful cytokinesis. May play a role in mitotic chromosomal positioning and bipolar spindle stabilization. -
Tissue specificity
Highly expressed in hematopoietic tissues, fetal liver, spleen, thymus and adult thymus and bone marrow. Lower levels are found in heart, testis, kidney, colon and lung. -
Sequence similarities
Belongs to the kinesin-like protein family. Chromokinesin subfamily.
Contains 1 kinesin-motor domain. -
Cellular localization
Nucleus matrix. Cytoplasm > cytoskeleton > spindle. Midbody. Chromosome. Not present in the nucleolus. In early mitosis, associated with the mitotic spindle, in anaphase, localized to the spindle midzone and, in telophase and cytokinesis, to the midbody. In late cytokinesis, found in the center of the midbody. Associated with chromosomes at all stages of mitosis. - Information by UniProt
-
Database links
- Entrez Gene: 24137 Human
- NCBI: 7305205 Human
- Omim: 300521 Human
- SwissProt: O95239 Human
- Unigene: 648326 Human
-
Alternative names
- Chromokinesin antibody
- Chromokinesin-A antibody
- Chromosome associated kinesin KIF4A antibody
see all
Images
-
All lanes : Anti-KIF4A/KIF4 antibody (ab122227) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate -
ab122227, at a 1/300 dilution, staining KIF4A/KIF4 in paraffin embedded Human bone marrow tissue by Immunohistochemistry.
-
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli using ab122227.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 -
Immunohistochemical staining of Human bone marrow shows strong nuclear positivity in hematopoietic cells using ab122227
-
ab122227, at 4 µg/ml, staining KIF4A/KIF4 in Human cell line U-2 OS by Immunofluorescence. Antibody staining is shown in green.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (10)
ab122227 has been referenced in 10 publications.
- Zheng P et al. KIF4A promotes the development of bladder cancer by transcriptionally activating the expression of CDCA3. Int J Mol Med 47:N/A (2021). PubMed: 33846765
- Pan J et al. Identification of KIF4A as a pan-cancer diagnostic and prognostic biomarker via bioinformatics analysis and validation in osteosarcoma cell lines. PeerJ 9:e11455 (2021). PubMed: 34055488
- Wang L et al. Identification of KIF4A as a prognostic biomarker for esophageal squamous cell carcinoma. Aging (Albany NY) 13:24050-24070 (2021). PubMed: 34775374
- Chen J et al. KIF4A Regulates the Progression of Pancreatic Ductal Adenocarcinoma through Proliferation and Invasion. Biomed Res Int 2021:8249293 (2021). PubMed: 34805404
- Feng S et al. miR-29c-3p regulates proliferation and migration in ovarian cancer by targeting KIF4A. World J Surg Oncol 18:315 (2020). PubMed: 33261630
- Liu G et al. The kinesin motor protein KIF4A as a potential therapeutic target in renal cell carcinoma. Invest New Drugs 38:1730-1742 (2020). PubMed: 32533288
- Chen J et al. KIF4A: A potential biomarker for prediction and prognostic of prostate cancer. Clin Invest Med 43:E49-59 (2020). PubMed: 32971585
- Jungwirth G et al. Identification of KIF11 As a Novel Target in Meningioma. Cancers (Basel) 11:N/A (2019). PubMed: 30991738
- Matsumoto Y et al. Enhanced expression of KIF4A in colorectal cancer is associated with lymph node metastasis. Oncol Lett 15:2188-2194 (2018). PubMed: 29434924
- Hou PF et al. KIF4A facilitates cell proliferation via induction of p21-mediated cell cycle progression and promotes metastasis in colorectal cancer. Cell Death Dis 9:477 (2018). PubMed: 29706624