Overview

  • Product name

  • Description

    Rabbit polyclonal to KIF4A/KIF4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIF4A/KIF4 aa 994-1075.
    Sequence:

    LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIED LKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL


    Database link: O95239

  • Positive control

    • WB: RT-4 and U-251 MG cell lysates IHC-P: Human bone marrow tissue ICC/IF: Human cell line U-2 OS

Properties

Applications

Our Abpromise guarantee covers the use of ab122227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml. The following steps are recommended prior to antibody incubation: cells fixation in ice cold 4% paraformaldehyde pH 7.2-7.3, followed by permeabilization with 0.1% Triton X-100 in PBS for 3x5 minutes.
WB 1/250 - 1/500.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Motor protein that translocates PRC1 to the plus ends of interdigitating spindle microtubules during the metaphase to anaphase transition, an essential step for the formation of an organized central spindle midzone and midbody and for successful cytokinesis. May play a role in mitotic chromosomal positioning and bipolar spindle stabilization.
  • Tissue specificity

    Highly expressed in hematopoietic tissues, fetal liver, spleen, thymus and adult thymus and bone marrow. Lower levels are found in heart, testis, kidney, colon and lung.
  • Sequence similarities

    Belongs to the kinesin-like protein family. Chromokinesin subfamily.
    Contains 1 kinesin-motor domain.
  • Cellular localization

    Nucleus matrix. Cytoplasm > cytoskeleton > spindle. Midbody. Chromosome. Not present in the nucleolus. In early mitosis, associated with the mitotic spindle, in anaphase, localized to the spindle midzone and, in telophase and cytokinesis, to the midbody. In late cytokinesis, found in the center of the midbody. Associated with chromosomes at all stages of mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chromokinesin antibody
    • Chromokinesin-A antibody
    • Chromosome associated kinesin KIF4A antibody
    • Chromosome-associated kinesin KIF4A antibody
    • FLJ12530 antibody
    • FLJ12655 antibody
    • FLJ14204 antibody
    • FLJ20631 antibody
    • HSA271784 antibody
    • KIF4 antibody
    • KIF4 G1 antibody
    • KIF4A antibody
    • KIF4A_HUMAN antibody
    • KIF4G1 antibody
    • Kinesin family member 4A antibody
    see all

Images

  • All lanes : Anti-KIF4A/KIF4 antibody (ab122227) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate
  • ab122227, at a 1/300 dilution, staining KIF4A/KIF4 in paraffin embedded Human bone marrow tissue by Immunohistochemistry.

  • Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli using ab122227.
    Recommended conditions:
    Fixation/Permeabilization: PFA/Triton X-100
  • Immunohistochemical staining of Human bone marrow shows strong nuclear positivity in hematopoietic cells using ab122227

  • ab122227, at 4 µg/ml, staining KIF4A/KIF4 in Human cell line U-2 OS by Immunofluorescence. Antibody staining is shown in green.

References

This product has been referenced in:

  • Matsumoto Y  et al. Enhanced expression of KIF4A in colorectal cancer is associated with lymph node metastasis. Oncol Lett 15:2188-2194 (2018). Read more (PubMed: 29434924) »
  • Hou PF  et al. KIF4A facilitates cell proliferation via induction of p21-mediated cell cycle progression and promotes metastasis in colorectal cancer. Cell Death Dis 9:477 (2018). Read more (PubMed: 29706624) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up