Question (24075) | Anti-KIF5B antibody (ab25715)

Go to datasheet (ab25715)

Question

You list the immunogen for this Kinesin antibody as "stalk domain of human kinesin (aa 331-906) expressed in E. coli (FKHC3)." Can you please tell me the amino acid sequence this corresponds to?

Answer

Thank you for contacting us. The immunogen sequence is as follows: VNVELTAEQWKKKYEKEKEKNKILRNTIQWLENELNRWRNGETVPIDEQFDKEKANLE AFTVDKDITLTNDKPATAIGVIGNFTDAERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKL KTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQ EVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGI AVGNNDVKQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTESNKKMEENE KELAACQLRISQHEAKIKSLTEYLQNVEQKKRQLEESVDALSEELVQLRAQEKVHEMEKE HLNKVQTANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLEQ ERLRVEHEKLKATDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLF VQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPK LEKRLRATAERVKALESALKEAKENASRDRKRYQQEVDRIKEAV Please let me know if you need any additional information.

Sign up