Overview

  • Product name

  • Description

    Rabbit polyclonal to KIF5C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human KIF5C aa 1-957.
    Sequence:

    MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFD RVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKL HDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVS KTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNE HSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLD EAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEK EKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIID NIAPVVAGISTEEKEKYDEEISSLYRQLDDKDDEINQQSQLAEKLKQQML DQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQ KSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEI LNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNM EQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMK KALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLS SDYNKLKIEDQEREMKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHN LRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENNLEQLTKVHKQ LVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSS NSTHYQK


    Database link: O60282

  • Positive control

    • NIH3T3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.1% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 109 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
  • Tissue specificity

    Highest expression in brain, prostate and testis, and moderate expression in kidney, small intestine and ovary.
  • Sequence similarities

    Belongs to the kinesin-like protein family. Kinesin subfamily.
    Contains 1 kinesin-motor domain.
  • Domain

    Composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it hydrolyzes ATP and binds microtubule), a central alpha-helical coiled coil domain that mediates the heavy chain dimerization; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDCBM2 antibody
    • FLJ44735 antibody
    • KIAA0531 antibody
    • KIF 5C antibody
    • Kif5c antibody
    • KIF5C protein antibody
    • KIF5C_HUMAN antibody
    • Kinesin family member 5C antibody
    • Kinesin heavy chain isoform 5C antibody
    • Kinesin heavy chain neuron specific 2 antibody
    • Kinesin heavy chain neuron specific antibody
    • Kinesin heavy chain neuron-specific 2 antibody
    • Kinesin5C antibody
    • KINN antibody
    • MGC111478 antibody
    • NKHC 2 antibody
    • NKHC antibody
    • NKHC-2 antibody
    • NKHC2 antibody
    see all

Images

  • Indirect Immunofluorescence analysis of NIH3T3 cells labeling KIF5C with ab205885.

References

ab205885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up