Overview

  • Product name

  • Description

    Rabbit polyclonal to Kinectin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Kinectin 1 aa 182-316.
    Sequence:

    ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHAT TYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAE VKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ


    Database link: Q86UP2

  • Positive control

    • WB: RT4 cell lysate. ICC/IF: U-251 MG cells. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 156 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin.
  • Tissue specificity

    High levels in peripheral blood lymphocytes, testis and ovary, lower levels in spleen, thymus, prostate, small intestine and colon.
  • Sequence similarities

    Belongs to the kinectin family.
  • Cellular localization

    Endoplasmic reticulum membrane. Vesicle membrane protein anchored to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • CG-1 antigen antibody
    • CG1 antibody
    • CG1 antigen antibody
    • KIAA0004 antibody
    • Kinectin antibody
    • Kinesin receptor antibody
    • Ktn1 antibody
    • KTN1_HUMAN antibody
    • MU-RMS-40.19 antibody
    see all

Images

  • Anti-Kinectin 1 antibody (ab224324) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 156 kDa

  • PFA-fixed/Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for Kinectin 1 (green) using ab224324 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human testis tissue stained for Kinectin 1 using ab224324 at 1/50 dilution in immunohistochemical analysis.

References

ab224324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up