Overview

  • Product name

  • Description

    Rabbit polyclonal to Kinectin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Kinectin 1 aa 1162-1325. (Expressed in E.coli).
    Sequence:

    ELERLRHENKAMENLRREREHLEIELEKAEVERSTYVMEVRELKDLLTEL QKKLDDSYSEAVRQNEELNLLKTQLNETHSKLQNEQTERKKVADDLHKAQ QSLNFIHSKISLKAAGDTVVIENNDISPEMGSPEKETMSVSLTQTVAHLQ QLLQEVNQQLTKEK


    Database link: D4A4Z9

  • Positive control

    • IHC-P: Rat stomach and testis tissues. WB: HeLa cell lysate; Recombinant rat Kinectin 1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 152 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin.
  • Tissue specificity

    High levels in peripheral blood lymphocytes, testis and ovary, lower levels in spleen, thymus, prostate, small intestine and colon.
  • Sequence similarities

    Belongs to the kinectin family.
  • Cellular localization

    Endoplasmic reticulum membrane. Vesicle membrane protein anchored to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • CG-1 antigen antibody
    • CG1 antibody
    • CG1 antigen antibody
    • KIAA0004 antibody
    • Kinectin antibody
    • Kinesin receptor antibody
    • Ktn1 antibody
    • KTN1_HUMAN antibody
    • MU-RMS-40.19 antibody
    see all

Images

  • Anti-Kinectin 1 antibody (ab231002) at 1/250 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 152 kDa

  • Anti-Kinectin 1 antibody (ab231002) at 1/250 dilution + Recombinant rat Kinectin 1 protein

    Predicted band size: 152 kDa

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Kinectin 1 using ab231002 at 20 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for kinectin 1 using ab231002 at 20 µg/ml in immunohistochemical analysis.

References

ab231002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up