Overview

  • Product name

  • Description

    Rabbit polyclonal to Kinectin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Kinectin 1 aa 1104-1357. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    ECMAGTSGSEEVKVLEHKLKEADEMHTLLQLECEKYKSVLAETEGILQKL QRSVEQEENKWKVKVDESHKTIKQMQSSFTSSEQELERLRSENKDIENLR REREHLEMELEKAEMERSTYVTEVRELKDLLTELQKKLDDSYSEAVRQNE ELNLLKAQLNETLTKLRTEQNERQKVAGDLHKAQQSLELIQSKIVKAAGD TTVIENSDVSPETESSEKETMSVSLNQTVTQLQQLLQAVNQQLTKEKEHY QVLE


    Database link: Q86UP2-1

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human Kinectin 1 protein; Human lung lysate; K562 and HEK-293T lysates; Pig kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin.
  • Tissue specificity

    High levels in peripheral blood lymphocytes, testis and ovary, lower levels in spleen, thymus, prostate, small intestine and colon.
  • Sequence similarities

    Belongs to the kinectin family.
  • Cellular localization

    Endoplasmic reticulum membrane. Vesicle membrane protein anchored to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • CG-1 antigen antibody
    • CG1 antibody
    • CG1 antigen antibody
    • KIAA0004 antibody
    • Kinectin antibody
    • Kinesin receptor antibody
    • Ktn1 antibody
    • KTN1_HUMAN antibody
    • MU-RMS-40.19 antibody
    see all

Images

  • Anti-Kinectin 1 antibody (ab232882) at 1 µg/ml + Pig kidney tissue lysate.
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Kinectin 1 using ab232882 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Kinectin 1 antibody (ab232882) at 1 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate.
  • Anti-Kinectin 1 antibody (ab232882) at 1 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate.
  • Anti-Kinectin 1 antibody (ab232882) at 1 µg/ml + Human lung tissue lysate.
  • Anti-Kinectin 1 antibody (ab232882) at 1 µg/ml + Recombinant human Kinectin 1 protein.

References

ab232882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up