Overview

  • Product name
  • Description
    Rabbit polyclonal to Kininogen 1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Kininogen 1 aa 1-644.
    Sequence:

    MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQS NNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAA KAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTA QYDCLGCVHP ISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRIT YSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNC DIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFY FKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQS LDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKE ETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHE RDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHK HGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPI PSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGL SFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS


    Database link: P01042

  • Positive control
    • Human plasma extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab175386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 72 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    (1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.
  • Tissue specificity
    Secreted in plasma. T-kinin is detected in malignant ovarian, colon and breast carcinomas, but not in benign tumors.
  • Involvement in disease
    Defects in KNG1 are the cause of high molecular weight kininogen deficiency (HMWK deficiency) [MIM:228960]. HMWK deficiency is an autosomal recessive coagulation defect. Patients with HWMK deficiency do not have a hemorrhagic tendency, but they exhibit abnormal surface-mediated activation of fibrinolysis.
  • Sequence similarities
    Contains 3 cystatin domains.
  • Post-translational
    modifications
    Bradykinin is released from kininogen by plasma kallikrein.
    Hydroxylation of Pro-383 occurs prior to the release of bradykinin.
    Phosphorylation sites are present in the extracelllular medium.
    N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha-2-thiol proteinase inhibitor antibody
    • BDK antibody
    • BK antibody
    • Bradykinin antibody
    • Bradykinin included antibody
    • Fitzgerald factor antibody
    • FLAUJEAC FACTOR antibody
    • High molecular weight kininogen antibody
    • HMWK antibody
    • Ile-Ser-Bradykinin antibody
    • Kallidin I antibody
    • Kallidin II antibody
    • KNG antibody
    • KNG1 antibody
    • KNG1_HUMAN antibody
    • Low molecular weight growth-promoting factor antibody
    • WILLIAMS FACTOR antibody
    • Williams-Fitzgerald-Flaujeac factor antibody
    see all

Images

  • Anti-Kininogen 1 antibody (ab175386) at 1/500 dilution + Human plasma extract

    Predicted band size: 72 kDa

References

This product has been referenced in:
  • Wu Z  et al. Identification of Potential Biomarkers for Rhegmatogenous Retinal Detachment Associated with Choroidal Detachment by Vitreous iTRAQ-Based Proteomic Profiling. Int J Mol Sci 17:N/A (2016). WB . Read more (PubMed: 27941623) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up