For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    kir21kcnj2-antibody-epr4530-ab109750.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels Potassium Channels
Share by email
RecombinantRabMAb

Recombinant Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)

  • Datasheet
  • SDS
Reviews (1)Q&A (2)References (5)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
  • Immunocytochemistry/ Immunofluorescence - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
  • Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)

Key features and details

  • Produced recombinantly (animal-free) for high batch-to-batch consistency and long term security of supply
  • Rabbit monoclonal [EPR4530] to Kir2.1/KCNJ2
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Human

Conjugates logo Related conjugates and formulations

Carrier Free

You may also be interested in

Biochemical
Product image
nor-Binaltorphimine (nor-BNI), kappa opioid receptor antagonist (ab120078)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
Primary
Product image
Alexa Fluor® 647 Anti-Aquaporin 5 antibody [EPR3747] (ab215225)

View more associated products

Overview

  • Product name

    Anti-Kir2.1/KCNJ2 antibody [EPR4530]
    See all Kir2.1/KCNJ2 primary antibodies
  • Description

    Rabbit monoclonal [EPR4530] to Kir2.1/KCNJ2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
    Unsuitable for: Flow Cyt or IP
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide. This information is proprietary to Abcam and/or its suppliers.

  • Positive control

    • 293T and A549 cell lysates; Human brain tissue; SH SY5Y cells.
  • General notes

    This product is a recombinant monoclonal antibody, which offers several advantages including:

    • - High batch-to-batch consistency and reproducibility
    • - Improved sensitivity and specificity
    • - Long-term security of supply
    • - Animal-free production
    For more information see here.

    Our RabMAb® technology is a patented hybridoma-based technology for making rabbit monoclonal antibodies. For details on our patents, please refer to RabMAb® patents.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.
  • Storage buffer

    pH: 7.20
    Preservative: 0.01% Sodium azide
    Constituents: 9% PBS, 40% Glycerol (glycerin, glycerine), 0.05% BSA, 50% Tissue culture supernatant
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    EPR4530
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Potassium Channels

Associated products

  • Alternative Versions

    • Anti-Kir2.1/KCNJ2 antibody [EPR4530] - BSA and Azide free (ab239988)
  • Isotype control

    • Rabbit IgG, monoclonal [EPR25A] - Isotype Control (ab172730)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab109750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF (1)
1/100 - 1/250.
WB
1/1000 - 1/10000. Predicted molecular weight: 48 kDa.
IHC-P
1/250 - 1/500. Perform heat mediated antigen retrieval via the pressure cooker method before commencing with IHC staining protocol.
Notes
ICC/IF
1/100 - 1/250.
WB
1/1000 - 1/10000. Predicted molecular weight: 48 kDa.
IHC-P
1/250 - 1/500. Perform heat mediated antigen retrieval via the pressure cooker method before commencing with IHC staining protocol.
Application notes
Is unsuitable for Flow Cyt or IP.

Target

  • Function

    Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium or cesium.
  • Tissue specificity

    Heart, brain, placenta, lung, skeletal muscle, and kidney. Diffusely distributed throughout the brain.
  • Involvement in disease

    Defects in KCNJ2 are the cause of long QT syndrome type 7 (LQT7) [MIM:170390]; also called Andersen syndrome or Andersen cardiodysrhythmic periodic paralysis. Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress. LQT7 manifests itself as a clinical triad consisting of potassium-sensitive periodic paralysis, ventricular ectopy and dysmorphic features.
    Defects in KCNJ2 are the cause of short QT syndrome type 3 (SQT3) [MIM:609622]. Short QT syndromes are heart disorders characterized by idiopathic persistently and uniformly short QT interval on ECG in the absence of structural heart disease in affected individuals. They cause syncope and sudden death. SQT3 has a unique ECG phenotype characterized by asymmetrical T waves.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ2 subfamily.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P63252 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 3759 Human
    • Entrez Gene: 16518 Mouse
    • Entrez Gene: 29712 Rat
    • Omim: 600681 Human
    • SwissProt: P63252 Human
    • SwissProt: P35561 Mouse
    • SwissProt: Q64273 Rat
    • Unigene: 1547 Human
    • Unigene: 4951 Mouse
    • Unigene: 44415 Rat
    see all
  • Alternative names

    • Cardiac inward rectifier potassium channel antibody
    • HHBIRK 1 antibody
    • HHBIRK1 antibody
    • HHIRK 1 antibody
    • HHIRK1 antibody
    • HIRK 1 antibody
    • hIRK1 antibody
    • Inward rectifier K antibody
    • Inward rectifier K(+) channel Kir2.1 antibody
    • Inward rectifier potassium channel 2 antibody
    • inwardly rectifying subfamily J member 2 antibody
    • IRK 1 antibody
    • IRK-1 antibody
    • IRK1 antibody
    • IRK2_HUMAN antibody
    • KCNJ2 antibody
    • KIR2.1 antibody
    • LQT 7 antibody
    • LQT7 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 2 antibody
    • Potassium inwardly rectifying channel J2 antibody
    • Potassium inwardly rectifying channel subfamily J member 2 antibody
    • SQT 3 antibody
    • SQT3 antibody
    see all

Images

  • Western blot - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
    Western blot - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
    All lanes : Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750) at 1/1000 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : A549 cell lysate

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 48 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)

    ab109750 at 1/250 dilution staining Kir2.1/KCNJ2 in Human brain by Immunohistochemistry, Paraffin-embedded tissue.

    Perform heat mediated antigen retrieval via the pressure cooker method before commencing with IHC staining protocol.

  • Immunocytochemistry/ Immunofluorescence - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
    Immunocytochemistry/ Immunofluorescence - Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)

    ab109750 at 1/100 dilution staining Kir2.1/KCNJ2 in SH SY5Y cells by Immunofluorescence.

  • Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)
    Anti-Kir2.1/KCNJ2 antibody [EPR4530] (ab109750)

Protocols

  • Western blot protocols
  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (5)

Publishing research using ab109750? Please let us know so that we can cite the reference in this datasheet.

ab109750 has been referenced in 5 publications.

  • Zhang JZ  et al. A Human iPSC Double-Reporter System Enables Purification of Cardiac Lineage Subpopulations with Distinct Function and Drug Response Profiles. Cell Stem Cell 24:802-811.e5 (2019). PubMed: 30880024
  • Fancher IS  et al. Hypercholesterolemia-Induced Loss of Flow-Induced Vasodilation and Lesion Formation in Apolipoprotein E-Deficient Mice Critically Depend on Inwardly Rectifying K+ Channels. J Am Heart Assoc 7:N/A (2018). WB ; Mouse . PubMed: 29502106
  • Cho JH  et al. Reverse electrical remodeling in rats with heart failure and preserved ejection fraction. JCI Insight 3:N/A (2018). WB ; Rat . PubMed: 30282820
  • Utrilla RG  et al. Kir2.1-Nav1.5 Channel Complexes Are Differently Regulated than Kir2.1 and Nav1.5 Channels Alone. Front Physiol 8:903 (2017). PubMed: 29184507
  • Li X  et al. Valsartan Upregulates Kir2.1 in Rats Suffering from Myocardial Infarction via Casein Kinase 2. Cardiovasc Drugs Ther 29:209-18 (2015). WB ; Rat . PubMed: 26095682

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-3 of 3 Abreviews or Q&A

Immunocytochemistry/ Immunofluorescence abreview for Anti-Kir2.1/BIK antibody [EPR4530]

Poor
Abreviews
Abreviews
abreview image
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.05% Triton X100 in PBS
Specification
HeLa
Fixative
Paraformaldehyde
Read More

DR. Kirk Mcmanus

Verified customer

Submitted May 10 2013

Question

Many thanks for your reply. Would it be possible for you to send me some samples of these Abs to test? There are no pictures of westerns on your website for ab65796 and ab80969. I can send you pics of any westerns we do with them.

For the western with ab109750 on your website, were the 293T cells transfected with Kir2.1? I don't think 293T cells express Kir2.1 endogenously.

Also, if you could possibly find out whether HeLa cells need to be treated with staurosporine to get a good Kir2.1 signal, that would be very useful info.

Best regards,

Read More

Abcam community

Verified customer

Asked on Mar 02 2012

Answer

Thank you for your message.

I am sorry to confirm that becuase we have over 70 000 products, it is not feasable for us to keep small sample vials to send to customers.

I would like to reassure you that ab65796 and ab80969 have been tested in western blot, and we provide our 6 month guarantee for this application. However, as they have been tested externally, we do not currently have a WB image for them.

Therefore, I can offer a discount off a future purchase if you buy either ab65796 or ab80969 now, use it WB and submit an image of your results to us in the form of an Abreview. The discount would be to the value of 1 free primary antibody.

It doesn’t matter whether the result is positive or negative, we would just really like to receive your feedback. Of course, if the results are negative you will be covered by our Abpromise guarantee and eligible for a refund or replacement.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed with this offer, and which of these two antibody you woudl like to try. I will then send a discount code. This code must be issued before purchasing the antibody so please wait for my reply before ordering.

2. Purchase ab65796 or ab80969 either by phone, fax, or online (www.abcam.com).

3. Use it in WB.

4. Send us an image of the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated!

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Please let me know if you have any questions about this offer and I would be happy to help you further.

With regards to ab109750, I can confirm that 293T cells express Kir2.1 endogenously, and no treatment is needed. Other suppliers also used 293T as a positive control with Kir2.1 antibodies.

The following paper describes Kir2.1 endogenously expressed in 293T cells:
http://jp.physoc.org/content/563/3/725.full.pdf

I hope this will be helpful to you. If you have any further questions, or if you would like to accept the testing offer, please do not hesitate to contact me.

Read More

Abcam Scientific Support

Answered on Mar 02 2012

Question

Hi Technical,



We have a customer who is interested in the following antibodies;



ab85492, ab109750, ab65796, ab80969, ab45390, ab71574.



Their question is as follows;



I'm interested in seeing whether your anti-kir2.1 antibodies will cross-react with the zebrafish kir2.1 protein. However, for the 6 anti-kir2.1 antibodies that you stock there are no details regarding the region the antibodies are targeting, and therefore I can't be sure which antibody is the best suited for my needs. I've included the amino acid sequence of the zebrafish kir2.1 in this email in hopes that you would be able to tell me which antibody target shares the highest homology with it and therefore may be able to cross-react with the zebrafish protein.



zebrafish kir2.1



MGSVRANRYSIVSSEEDGMKLATAAVPNGYGNGKSKVHTRHQTQSRFVKKDGHCNVQFIN

VSEKSQRYLADIFTTCVDIRWRWMFVIFCLAFLLSWLFFGCIFWLVAIFHGDLENNGHKC

VSNVSSFTAAFLFSIETQTTIGYGYRYVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAK

MAKPKKRNETLVFSHNATVAMRDNKLCLMWRVGNLRKSHLVEAHVRAQLLRSRTTAEREF

IPLDQMDIDVGFDSGIDRIFLVSPITIVHEIDEDSPFYDMSKQEMENSDFEIVVILEGMV

EATAMTTQCRSSYVANEILWAHRFEPVLFEEKNYYKVDYSRFHKTYEVPSTPLCSARDLA

EKKYIISNSNSFCYENEVALSNKEEKEEGHGDSLGPGGTNTETSSDSEHSQATVPLEPRP

LRRESEI



According to the datasheet, they have not been tested with Zebrafish, so I would assume that you can’t confirm for them, but it is best to check. I will also mention to them of Abcam’s testing discount.



Looking forward to your response.





Kind regards,

Read More

Abcam community

Verified customer

Asked on May 16 2012

Answer

Thank youand your customer very much for your interest in our antibodies.

I checked all immunogens and homology to zebrafish (sequnec that your customer provided)of the Kir2.1 antibodies we offer at the moment.

Only one antibody shows a sufficiently high homology to expect cross-reactivity: ab71574



Therefore, I can offer a discount off a future purchase if your customerbuys ab71574 now, tests it inzebrafish and submits feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your customer'sfeedback. The discount would be to the value of ab71574 and can be used to order any product.

If your customer is interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that your customer ( please include theire-mail address)would like to proceed and test ab71574 in zebrafish. I will then send a discount code. This code must be issued before purchasing ab71574 so please wait for my reply before ordering.

2. Purchase ab71574 either by phone, fax, or online (www.abcam.com).

3. Test it in zebrafish.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your customer's new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for anyproduct ordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab71574turns out to be unsuitable for zebrafish, your customerwill still receive the discount ontheir next purchase after your Abreview has been submitted.

Please let me know if you or your customer have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Abcam Scientific Support

Answered on May 16 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.