Overview

  • Product name

  • Description

    Rabbit polyclonal to KIR2.3/HIR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human KIR2.3/HIR aa 316-445.
    Sequence:

    HRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPP PPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIR MLEFGSHLDLERMQASLPLDNISYRRESAI


    Database link: P48050

  • Positive control

    • WB: A549, HeLa, HEK-293T, HepG2, Jurkat and MCF7 whole cell lysates; Rat heart lysate. IHC-P: Human skeletal muscle and heart tissues.
  • General notes

    Previously labelled as KIR2.3.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 50 kDa.

Target

  • Function

    This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium.
  • Tissue specificity

    Heart, skeletal muscle, and several different brain regions including the hippocampus.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ4 subfamily.
  • Domain

    The Val/Gly/Ala/Pro stretch may have a functional role in the conductance or permeation properties.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle membrane. TAX1BP3 binding promotes dissociation of KCNJ4 from LIN7 famaly members and KCNJ4 internalization.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hippocampal inward rectifier antibody
    • Hippocampal inward rectifier potassium channel antibody
    • HIR antibody
    • HIRK2 antibody
    • HRK1 antibody
    • Inward rectifier K(+) channel Kir2.3 antibody
    • Inward rectifier K+ channel Kir2.3 antibody
    • Inward rectifier potassium channel 4 antibody
    • Inward rectifier potassium channel Kir 2.3 antibody
    • inwardly rectifying subfamily J member 4 antibody
    • IRK-3 antibody
    • IRK3 antibody
    • IRK4_HUMAN antibody
    • KCNJ 4 antibody
    • Kcnj4 antibody
    • Kir2.3 antibody
    • MGC142066 antibody
    • MGC142068 antibody
    • OTTHUMP00000028922 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 4 antibody
    • Potassium inwardly rectifying channel J4 antibody
    • Potassium inwardly rectifying channel subfamily J member 4 antibody
    see all

Images

  • All lanes : Anti-KIR2.3/HIR antibody (ab230214) at 1/1000 dilution

    Lane 1 : Rat heart tissue lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 7 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 50 kDa
    Observed band size: 50 kDa

  • Paraffin-embedded human skeletal muscle tissue stained for KIR2.3/HIR using ab230214 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for KIR2.3/HIR using ab230214 at 1/100 dilution in immunohistochemical analysis.

References

ab230214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up