Overview

  • Product name

    Anti-KIR3DL1 antibody [2C3B6]
    See all KIR3DL1 primary antibodies
  • Description

    Mouse monoclonal [2C3B6] to KIR3DL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIR3DL1 aa 206-340. Expressed in E.coli.
    Sequence:

    LSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHL SREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWS DPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH


    Database link: P43629

  • Positive control

    • WB: Recombinant human KIR3DL1 (aa 206-340) protein; Human KIR3DL1 (aa 206-340)-hIgG-Fc-transfected HEK-293 cell lysate. IHC-P: Human cervical cancer tissue. Flow cyt: HL-60 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2C3B6
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 49 kDa.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMB11 antibody
    • CD158 antigen-like family member E antibody
    • CD158e antibody
    • CD158e antigen antibody
    • CD158E1 antibody
    • CD158E1/2 antibody
    • CD158E2 antibody
    • CL11 antibody
    • CL2 antibody
    • HLA-BW4-specific inhibitory NK cell receptor antibody
    • KI3L1_HUMAN antibody
    • killer cell immunoglobulin like receptor antibody
    • Killer cell immunoglobulin like receptor three domains , short cytoplasmic tail, 1 antibody
    • Killer cell immunoglobulin like receptor three domains long cytoplasmic tail 1 antibody
    • Killer cell immunoglobulin-like receptor 3DL1 antibody
    • KIR antibody
    • KIR antigen 3DL1 antibody
    • KIR G1 antibody
    • Kir3dl1 antibody
    • KIR3DS1 antibody
    • Kirl1 antibody
    • Kirl2 antibody
    • Krl1 antibody
    • MGC119726 antibody
    • MGC119728 antibody
    • MGC126589 antibody
    • MGC126591 antibody
    • MHC class I NK cell receptor antibody
    • Natural killer associated transcript 3 antibody
    • Natural killer cell inhibitory receptor antibody
    • Natural killer-associated transcript 3 antibody
    • NK receptor antibody
    • NK-associated transcript 10 antibody
    • NK-associated transcript 3 antibody
    • NK-associated transcript 3delIg1 antibody
    • NKAT-3 antibody
    • NKAT10 antibody
    • NKAT3 antibody
    • NKB1 antibody
    • NKB1B antibody
    • p70 killer cell inhibitory receptor antibody
    • p70 natural killer cell receptor clones CL 2/CL 11 antibody
    • p70 natural killer cell receptor clones CL-2/CL-11 antibody
    • p70 NK receptor CL-2/CL-11 antibody
    see all

Images

  • Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling KIR3DL1 with ab233780 at 1/200 dilution (green) compared with a negative control (red).

  • Anti-KIR3DL1 antibody [2C3B6] (ab233780) at 1/500 dilution + Recombinant human KIR3DL1 (aa 206-340) protein

    Predicted band size: 49 kDa



    Expected MW is 40.5 kDa.

  • All lanes : Anti-KIR3DL1 antibody [2C3B6] (ab233780) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human KIR3DL1 (aa 206-340)-hIgG-Fc-transfected HEK-293 cell lysate

    Predicted band size: 49 kDa

  • Paraffin-embedded human cervical cancer tissue stained for KIR3DL1 using ab233780 at 1/200 dilution in immunohistochemical analysis. DAB staining.

References

ab233780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up