Overview

  • Product name

  • Description

    Rabbit polyclonal to KIR3DL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIR3DL1 aa 81-336.
    Sequence:

    NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHP GPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANF SIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQP GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPS SKSGNP


    Database link: P43629

  • Positive control

    • WB: HepG2 and A549 cell lysate. IHC-P: Human liver and brain tissue. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 49 kDa.

Target

  • Function

    Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMB11 antibody
    • CD158 antigen-like family member E antibody
    • CD158e antibody
    • CD158e antigen antibody
    • CD158E1 antibody
    • CD158E1/2 antibody
    • CD158E2 antibody
    • CL11 antibody
    • CL2 antibody
    • HLA-BW4-specific inhibitory NK cell receptor antibody
    • KI3L1_HUMAN antibody
    • killer cell immunoglobulin like receptor antibody
    • Killer cell immunoglobulin like receptor three domains , short cytoplasmic tail, 1 antibody
    • Killer cell immunoglobulin like receptor three domains long cytoplasmic tail 1 antibody
    • Killer cell immunoglobulin-like receptor 3DL1 antibody
    • KIR antibody
    • KIR antigen 3DL1 antibody
    • KIR G1 antibody
    • Kir3dl1 antibody
    • KIR3DS1 antibody
    • Kirl1 antibody
    • Kirl2 antibody
    • Krl1 antibody
    • MGC119726 antibody
    • MGC119728 antibody
    • MGC126589 antibody
    • MGC126591 antibody
    • MHC class I NK cell receptor antibody
    • Natural killer associated transcript 3 antibody
    • Natural killer cell inhibitory receptor antibody
    • Natural killer-associated transcript 3 antibody
    • NK receptor antibody
    • NK-associated transcript 10 antibody
    • NK-associated transcript 3 antibody
    • NK-associated transcript 3delIg1 antibody
    • NKAT-3 antibody
    • NKAT10 antibody
    • NKAT3 antibody
    • NKB1 antibody
    • NKB1B antibody
    • p70 killer cell inhibitory receptor antibody
    • p70 natural killer cell receptor clones CL 2/CL 11 antibody
    • p70 natural killer cell receptor clones CL-2/CL-11 antibody
    • p70 NK receptor CL-2/CL-11 antibody
    see all

Images

  • PC-3 (human prostate adenocarcinoma cell line) cells labeling KIR3DL1 (green) using ab234823 at 1/100 dilution in ICC/IF. Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

  • Paraffin-embedded human liver tissue stained for KIR3DL1 using ab234823 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-KIR3DL1 antibody (ab234823) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa

  • Paraffin-embedded human brain tissue stained for KIR3DL1 using ab234823 at 1/100 dilution in immunohistochemical analysis.

References

ab234823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up