Overview

  • Product name

    Anti-KIR3DL2 antibody - C-terminal
  • Description

    Rabbit polyclonal to KIR3DL2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human KIR3DL2 aa 351-400 (C terminal). The exact sequence is proprietary. (NP_006728.2)
    Sequence:

    LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ


    Database link: P43630

  • Positive control

    • HeLa whole cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa.

Target

  • Function

    Receptor on natural killer (NK) cells for HLA-A alleles. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD158 antigen like family member K antibody
    • CD158 antigen-like family member K antibody
    • CD158k antibody
    • KI3L2_HUMAN antibody
    • Killer cell immunoglobulin like receptor 3DL2 antibody
    • killer cell immunoglobulin like receptor KIR3DL2 antibody
    • Killer cell immunoglobulin like receptor, three domains, long cytoplasmic tail, 2 antibody
    • Killer cell immunoglobulin-like receptor 3DL2 antibody
    • KIR antigen 3DL2 antibody
    • KIR3DL2 antibody
    • Kirl2 antibody
    • MHC class I NK cell receptor antibody
    • Natural killer associated transcript 4 antibody
    • natural killer cell inhibitory receptor antibody
    • Natural killer-associated transcript 4 antibody
    • NK associated transcript 4 antibody
    • NK associated transcript 4A, included antibody
    • NK associated transcript 4B, included antibody
    • NKAT-4 antibody
    • NKAT4 antibody
    • NKAT4B antibody
    • p140 antibody
    • p70 natural killer cell receptor clone CL 5 antibody
    • p70 natural killer cell receptor clone CL-5 antibody
    • p70 NK receptor CL 5 antibody
    • p70 NK receptor CL-5 antibody
    see all

Images

  • Anti-KIR3DL2 antibody - C-terminal (ab178749) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Predicted band size: 50 kDa

References

ab178749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up