Overview

  • Product name

  • Description

    Rabbit polyclonal to KIRREL 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human KIRREL 3 aa 670-768.
    Sequence:

    PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDS SSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR


    Database link: Q8IZU9

  • Positive control

    • Human cerebellum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    NEPH2 is a member of the nephrin like protein family, which includes NEPH1 (KIRREL; MIM 607428) and NEPH3 (KIRREL2; MIM 607762). The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2; MIM 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size and charge selective ultrafiltration (Sellin et al., 2003 [PubMed 12424224]).
  • Cellular localization

    Cell membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • KIAA1867 antibody
    • Kin of IRRE like 3 (Drosophila) antibody
    • Kin of IRRE like 3 antibody
    • kin of IRRE-like protein 3 antibody
    • Kin of irregular chiasm like protein 3 antibody
    • KIRRE antibody
    • KIRRE, mouse, homolog of antibody
    • KIRREL3 antibody
    • MRD4 antibody
    • NEPH2 antibody
    • Nephrin like 2 antibody
    • Nephrin like protein 2 antibody
    • PRO19814 antibody
    • PRO4502 antibody
    • UNQ5923 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling KIRREL 3 using ab204492 at a 1/1000 dilution.

References

ab204492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up