Anti-KIRREL2 antibody (ab254990)
Key features and details
- Rabbit polyclonal to KIRREL2
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KIRREL2 antibody
See all KIRREL2 primary antibodies -
Description
Rabbit polyclonal to KIRREL2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human KIRREL2 aa 228-285.
Sequence:EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLE VVADASFL
Database link: Q6UWL6 -
Positive control
- ICC/IF: REH cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab254990 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Tissue specificity
Highly expressed in beta-cells of the pancreatic islets. -
Sequence similarities
Belongs to the immunoglobulin superfamily.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 84063 Human
- Omim: 607762 Human
- SwissProt: Q6UWL6 Human
- Unigene: 145729 Human
-
Alternative names
- FILTRIN antibody
- Kin of IRRE like 2 (Drosophila) antibody
- Kin of IRRE-like protein 2 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-KIRREL2 antibody (ab254990)PFA fixed, Triton X-100 permeabilized REH (Human cell line) cells labeling KIRREL2 using ab254990 at 4µg/ml (green) in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab254990 has not yet been referenced specifically in any publications.
