
  • Product name
  • Description
    Rabbit polyclonal to KIRREL2
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 71-120 (WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVL V) of Human KIRREL2, (NP_115499)

  • Positive control
    • Fetal liver lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab83014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 75 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-KIRREL2 antibody (ab83014) at 1 µg/ml + Fetal liver lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 75 kDa
    Observed band size: 64 kDa (why is the actual band size different from the predicted?)


ab83014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83014.
Please use the links above to contact us or submit feedback about this product.


Sign up