Overview

  • Product name

    Anti-KIST/KIS antibody
  • Description

    Rabbit polyclonal to KIST/KIS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human KIST/KIS aa 183-385.
    Sequence:

    KEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIIL LEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIK SMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDD YLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDS KAA


    Database link: Q8TAS1

  • Positive control

    • IHC-P: Human prostate tissue. ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as KIST

     

Properties

Applications

Our Abpromise guarantee covers the use of ab237501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Upon serum stimulation, phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. May be involved in trafficking and/or processing of RNA.
  • Tissue specificity

    Widely expressed, with highest levels in skeletal muscle, kidney, placenta and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization

    Nucleus. Mostly nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp434C1613 antibody
    • FLJ23015 antibody
    • kinase interacting with leukemia-associated gene (stathmin) antibody
    • Kinase interacting with stathmin antibody
    • KIS antibody
    • KIS protein kinase antibody
    • KIST antibody
    • OTTHUMP00000029529 antibody
    • P-CIP2 antibody
    • Serine threonine protein kinase Kist antibody
    • Serine/threonine-protein kinase Kist antibody
    • U2AF homology motif (UHM) kinase 1 antibody
    • U2AF homology motif kinase 1 antibody
    • UHMK1 antibody
    • UHMK1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for KIST/KIS using ab237501 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for KIST/KIS (green) using ab237501 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up