Overview

  • Product name

    Anti-KK-LC-1 antibody [CL4762]
    See all KK-LC-1 primary antibodies
  • Description

    Mouse monoclonal [CL4762] to KK-LC-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human KK-LC-1 aa 25-113.
    Sequence:

    QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSI ARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST


    Database link: Q5H943

  • Epitope

    Binds to an epitope located within the peptide sequence STALALVRPSSSGLI as determined by overlapping synthetic peptides.
  • Positive control

    • Human testis tissue; HeLa cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL4762
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 13 kDa.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded human testis tissue labeling KK-LC-1 with ab219971 at 1/500 dilution.

  • Anti-KK-LC-1 antibody [CL4762] (ab219971) at 1/500 dilution + HeLa cell lysate

    Predicted band size: 13 kDa

References

ab219971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up