Overview

  • Product name

  • Description

    Rabbit polyclonal to KLB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human KLB aa 517-636. Expressed in E.coli.
    Sequence:

    VQGQFPCDFSWGVTESVLKPESVASSPQFSDPHLYVWNATGNRLLHRVEG VRLKTRPAQCTDFVNIKKQLEMLARMKVTHYRFALDWASVLPTGNLSAVN RQALRYYRCVVSEGLKLGIS


    Database link: Q86Z14

  • Positive control

    • WB: Recombinant human KLB protein. IHC-P: Human liver, pancreas and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 120 kDa.

Target

  • Function

    Contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. Probably inactive as a glycosidase. Increases the ability of FGFR1 and FGFR4 to bind FGF21.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 1 family. Klotho subfamily.
  • Domain

    Contains 2 glycosyl hydrolase 1 regions. However, the first region lacks the essential Glu active site residue at position 241, and the second one lacks the essential Glu active site residue at position 889. These domains are therefore predicted to be inactive.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta-klotho antibody
    • BetaKlotho antibody
    • BKL antibody
    • KLB antibody
    • KLOTB_HUMAN antibody
    • Klotho beta like protein antibody
    • Klotho beta-like protein antibody
    see all

Images

  • Anti-KLB antibody (ab233416) at 2 µg/ml + Recombinant human KLB protein

    Predicted band size: 120 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for KLB using ab233416 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for KLB using ab233416 at 20 μg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for KLB using ab233416 at 20 μg/ml in immunohistochemical analysis. AEC staining.

References

ab233416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up