Overview

  • Product name

  • Description

    Rabbit polyclonal to KLF12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human KLF12 aa 10-87.
    Sequence:

    IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLN NVKGEPPEDSLSVDHFQTQTEPVDLSIN


    Database link: Q9Y4X4

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Confers strong transcriptional repression to the AP-2-alpha gene. Binds to a regulatory element (A32) in the AP-2-alpha gene promoter.
  • Sequence similarities

    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2700063E05Rik antibody
    • AI225908 antibody
    • AI315654 antibody
    • AP-2 repressor antibody
    • AP-2rep antibody
    • AP-2rep transcription factor antibody
    • AP2REP antibody
    • B130052C06Rik antibody
    • D530033K05Rik antibody
    • HSPC122 antibody
    • KLF12 antibody
    • KLF12 zinc finger transcriptional repressor antibody
    • KLF12_HUMAN antibody
    • Krueppel like factor 12 antibody
    • Krueppel-like factor 12 antibody
    • OTTHUMP00000018503 antibody
    • Transcriptional repressor AP 2rep antibody
    • Transcriptional repressor AP-2rep antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for KLF12 (green) using ab221602 at 4 µg/ml in ICC/IF. 

References

ab221602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up