Overview

  • Product name

  • Description

    Rabbit polyclonal to KLF12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KLF12 aa 36-313.
    Sequence:

    LESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLS INKARTSPTAVSSSPVSMTASASSPSSTSTSSSSSSRLASSPTVITSVSS ASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHR IPVVVQSVPVVYTAVRSPGNVNNTIVVPLLEDGRGHGKAQMDPRGLSPRQ SKSDSDDDDLPNVTLDSVNETGSTALSIARAVQEVHPSPVSRVRGNRMNN QKFPCSISPFSIESTRRQRRSESPDSRK


    Database link: Q9Y4X4

  • Positive control

    • WB: Mouse kidney lysate; Rat liver and brain lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab229828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 45 kDa (predicted molecular weight: 44 kDa).

Target

  • Function

    Confers strong transcriptional repression to the AP-2-alpha gene. Binds to a regulatory element (A32) in the AP-2-alpha gene promoter.
  • Sequence similarities

    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2700063E05Rik antibody
    • AI225908 antibody
    • AI315654 antibody
    • AP-2 repressor antibody
    • AP-2rep antibody
    • AP-2rep transcription factor antibody
    • AP2REP antibody
    • B130052C06Rik antibody
    • D530033K05Rik antibody
    • HSPC122 antibody
    • KLF12 antibody
    • KLF12 zinc finger transcriptional repressor antibody
    • KLF12_HUMAN antibody
    • Krueppel like factor 12 antibody
    • Krueppel-like factor 12 antibody
    • OTTHUMP00000018503 antibody
    • Transcriptional repressor AP 2rep antibody
    • Transcriptional repressor AP-2rep antibody
    see all

Images

  • All lanes : Anti-KLF12 antibody (ab229828) at 1/500 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Rat liver lysate
    Lane 3 : Rat brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa
    Observed band size: 45 kDa
    why is the actual band size different from the predicted?

References

ab229828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up