Overview

  • Product name

  • Description

    Mouse polyclonal to KLF2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human KLF2 aa 1-56 (N terminal). NP_057354
    Sequence:

    MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILS MGLDGL


    Database link: Q9Y5W3

  • Positive control

    • Raw 264.7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab194486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 37 kDa.

Target

  • Function

    Binds to the CACCC box in the beta-globin gene promoter and activates transcription.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Ubiquitinated. Polyubiquitination involves WWP1 and leads to proteasomal degradation of this protein.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KLF 2 antibody
    • Klf2 antibody
    • KLF2_HUMAN antibody
    • Krueppel-like factor 2 antibody
    • Kruppel like factor 2 antibody
    • Kruppel like factor antibody
    • Kruppel like factor LKLF antibody
    • Kruppel-like factor 2 (lung) antibody
    • Lklf antibody
    • Lung krueppel like factor antibody
    • Lung krueppel-like factor antibody
    • Lung Kruppel like zinc finger transcription factor antibody
    see all

Images

  • Anti-KLF2 antibody (ab194486) at 1/500 dilution + Raw 264.7 cell lysate at 50 µg

    Predicted band size: 37 kDa

  • Anti-KLF2 antibody (ab194486) at 1/1000 dilution + Recombinant immunogen protein at 0.2 µg

    Predicted band size: 37 kDa

References

ab194486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
IHC - Wholemount
Sample
Mouse Embryo (E3.75 mouse blastocyst)
Specification
E3.75 mouse blastocyst

Mr. Vidur Garg

Verified customer

Submitted Oct 23 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up