Overview

  • Product name

    Anti-KLF2 antibody [OTI5F1]
    See all KLF2 primary antibodies
  • Description

    Mouse monoclonal [OTI5F1] to KLF2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human KLF2 aa 1-355. (NP_057354) produced in E.coli.
    Sequence:

    MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILS MGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPEL DAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKRE GAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGP GFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPL ELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH MKRHM


    Database link: Q9Y5W3

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY KLF2 whole cell lysate.
  • General notes

    Clone OTI5F1 (formerly 5F1).

Properties

Applications

Our Abpromise guarantee covers the use of ab236507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Binds to the CACCC box in the beta-globin gene promoter and activates transcription.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Ubiquitinated. Polyubiquitination involves WWP1 and leads to proteasomal degradation of this protein.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KLF 2 antibody
    • Klf2 antibody
    • KLF2_HUMAN antibody
    • Krueppel-like factor 2 antibody
    • Kruppel like factor 2 antibody
    • Kruppel like factor antibody
    • Kruppel like factor LKLF antibody
    • Kruppel-like factor 2 (lung) antibody
    • Lklf antibody
    • Lung krueppel like factor antibody
    • Lung krueppel-like factor antibody
    • Lung Kruppel like zinc finger transcription factor antibody
    see all

Images

  • All lanes : Anti-KLF2 antibody [OTI5F1] (ab236507) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY KLF2 whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 37 kDa

References

ab236507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
IHC - Wholemount
Sample
Mouse Embryo (E3.75 mouse blastocyst)
Specification
E3.75 mouse blastocyst

Mr. Vidur Garg

Verified customer

Submitted Oct 23 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up