Overview

  • Product name

    Anti-KLF7 antibody
  • Description

    Rabbit polyclonal to KLF7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Fusion protein corresponding to Human KLF7 aa 1-230. The identity of the protein fusion partner is GST.
    Sequence:

    MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRI SETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLS RDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVK TSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSR GTTGNTQVQSPSNATTATGVFPGLTILPST


    Database link: O75840-3

  • Positive control

    • Human colon cancer and fetal brain tissue lysates; Mouse kidney tissue and testis tissue lysates; Human thyroid cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 25 kDa.

Target

  • Function

    Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.
  • Tissue specificity

    Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Domain

    The acidic N-terminal part may favor interaction with the basic domain of transcription factors.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KLF7 antibody
    • KLF7_HUMAN antibody
    • Krueppel like factor 7 antibody
    • Krueppel-like factor 7 antibody
    • Kruppel like factor 7 antibody
    • Ubiquitous krueppel like factor antibody
    • Ubiquitous krueppel-like factor antibody
    • UKLF antibody
    see all

Images

  • All lanes : Anti-KLF7 antibody (ab197690) at 1/483 dilution

    Lane 1 : Human colon cancer tissue lysate
    Lane 2 : Mouse kidney tissue lysate
    Lane 3 : Mouse testis tissue lysate
    Lane 4 : Human fetal brain tissue lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 25 kDa


    Exposure time: 20 seconds


    8% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling KLF7 with ab197690 at 1/60 dilution.

References

This product has been referenced in:

  • Lv JX  et al. Hypoxia-induced miR-210 contributes to apoptosis of mouse spermatocyte GC-2 cells by targeting Kruppel-like factor 7. Mol Med Rep N/A:N/A (2018). Read more (PubMed: 30431115) »
  • Klein RH  et al. Characterization of enhancers and the role of the transcription factor KLF7 in regulating corneal epithelial differentiation. J Biol Chem 292:18937-18950 (2017). Read more (PubMed: 28916725) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up