Overview

  • Product name

  • Description

    Rabbit polyclonal to KLF8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human KLF8 aa 60-118.
    Sequence:

    PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIR PPKPQSSPQ


    Database link: O95600

  • Positive control

    • ICC/IF: RT4 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Sumoylation at Lys-67 represses transcriptional activity and reduces cell cycle progression into the G(1) phase. Has no effect on subcellular location.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basic krueppel-like factor 3 antibody
    • BKLF3 antibody
    • DXS741 antibody
    • KLF8 antibody
    • KLF8_HUMAN antibody
    • Krueppel-like factor 8 antibody
    • Kruppel like factor 8 antibody
    • MGC138314 antibody
    • Zinc finger protein 741 antibody
    • ZNF741 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for KLF8 (green) using ab221867 at 4 µg/ml in ICC/IF.

References

ab221867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up