Overview

  • Product name

    Anti-KLHL12 antibody
  • Description

    Rabbit polyclonal to KLHL12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human KLHL12 aa 70-120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVK Q


    Database link: Q53G59

  • Positive control

    • Rat tongue and mouse intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 44 kDa (predicted molecular weight: 44 kDa).
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 - 1/200.

Target

  • Function

    Serves as a substrate-specific adapter for the CUL3-based ubiquitin-protein E3 ligase complex. Negatively regulates the Wnt signaling pathway via the targeted ubiquitination and subsequent proteolysis of DVL3.
  • Tissue specificity

    Highly expressed in testis and at lower levels in the submandibular salivary gland.
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Domain

    The BTB domain is required for interaction with CUL3.
  • Information by UniProt
  • Database links

  • Alternative names

    • C3IP1 antibody
    • CUL3 interacting protein 1 antibody
    • CUL3-interacting protein 1 antibody
    • DKIR antibody
    • DKIR homolog antibody
    • FLJ27152 antibody
    • hDKIR antibody
    • Kelch like 12 (Drosophila) antibody
    • Kelch like 12 antibody
    • Kelch like 12 variant antibody
    • Kelch like protein 12 antibody
    • Kelch like protein C3IP1 antibody
    • kelch-like family member 12 antibody
    • Kelch-like protein 12 antibody
    • KLH12_HUMAN antibody
    • KLHL 12 antibody
    • klhl12 antibody
    • OTTHUMP00000038799 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat tongue, labeling KLHL12 using ab203880 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse intestine, labeling KLHL12 using ab203880 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-KLHL12 antibody (ab203880) at 1/200 dilution

    Lane 1 : Mouse brain lysates
    Lane 2 : Human colon carcinoma lysates

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated

    Predicted band size: 44 kDa
    Observed band size: 44 kDa

References

ab203880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up